PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0106s0450.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 355aa    MW: 36941.7 Da    PI: 8.1899
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0106s0450.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702211.61.9e-651402993154
                  DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsst 89 
                             s t++C+dCGnqakkdC+h+RCRtCCksrgfdC+thvkstWv+aa+rrerq   a+a   a ++ +++ sk++r   +++++++s+t
  SapurV1A.0106s0450.1.p 140 SATTTCEDCGNQAKKDCSHRRCRTCCKSRGFDCSTHVKSTWVAAARRRERQLI-ATAGGGAGSTGSTSGSKKPRLI-NSQTTTTSHT 224
                             57899********************************************9655.4555666777788999999975.788899999* PP

                  DUF702  90 klssaeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                             ++s+++++++ +tss          +P +v ++avfrcvrv++v+dge+e+aYq++v+igGhvfkG+Lyd+G+e+
  SapurV1A.0106s0450.1.p 225 STSNTTPPRSYDTSSshqdagfkerFPGQVTAPAVFRCVRVTAVEDGEDEYAYQAVVKIGGHVFKGFLYDHGIET 299
                             ************9999********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.3E-60142298IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.1E-26144186IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.3E-29249297IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGMLGLRDVF VVAPAASFNH HHHQHHEQIN LSTADPINAS NATALGVGVG VGVIPLLPSA  60
PCLTPLNMDD QDLLNNGRNK ISGIHQFWQN QGSQYIKKAS NTTPSILDHH NMSSTANLLL  120
QSGNGGGNGS GNLGGNSSSS ATTTCEDCGN QAKKDCSHRR CRTCCKSRGF DCSTHVKSTW  180
VAAARRRERQ LIATAGGGAG STGSTSGSKK PRLINSQTTT TSHTSTSNTT PPRSYDTSSS  240
HQDAGFKERF PGQVTAPAVF RCVRVTAVED GEDEYAYQAV VKIGGHVFKG FLYDHGIETR  300
DGFPNISELH LGGAGDGTGR HGASSSSPIL DPSAVYGASA GGLLAGSAFG NPIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024965.11e-179PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like isoform X2
SwissprotQ94CK92e-91LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLU5G3K71e-174U5G3K7_POPTR; Uncharacterized protein
STRINGPOPTR_0009s07510.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-74Lateral root primordium (LRP) protein-related